PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_07474.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 328aa    MW: 34846.3 Da    PI: 7.3859
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_07474.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.33.9e-393192263
                   zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                             k++al+cprC+s ntkfCyynnysl+qPryfCk C+ryWt+GG+lrn+P+Ggg rknk+sss
  Rsa1.0_07474.1_g00001.1 31 KDQALNCPRCNSLNTKFCYYNNYSLTQPRYFCKDCKRYWTQGGSLRNIPIGGGIRKNKRSSS 92
                             7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-302283IPR003851Zinc finger, Dof-type
PfamPF027011.7E-333289IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.4353589IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MNETCLRQSN PAAAAAAAAA APVEKKAKPE KDQALNCPRC NSLNTKFCYY NNYSLTQPRY  60
FCKDCKRYWT QGGSLRNIPI GGGIRKNKRS SSSSNSSSSS SSKKTLFADN KTPPPLQQLN  120
LKTAENNHVA AAAKVQELAY SHGLGNAHEA KDLNSAFSQG FGIGHHHHHQ SIPEFLQVAP  180
SSALVSTSSA LELLGISNSS ATSSNSHPTF VTYPNVHDSS VFTAASPGFG LSYPQFQEFM  240
RPPLGFSLDG GDPIHQEEGS SGTDIGRPLL LFESLKLHVS SSSTNSGGAN GNDHEREKEE  300
GEADNSVGFW NGMLSAGDAA ASAGGPWQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00210DAPTransfer from AT1G64620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0848983e-74AY084898.1 Arabidopsis thaliana clone 120488 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009112847.11e-169PREDICTED: dof zinc finger protein DOF1.8
RefseqXP_013608859.11e-169PREDICTED: dof zinc finger protein DOF1.8 isoform X1
SwissprotQ84JQ81e-134DOF18_ARATH; Dof zinc finger protein DOF1.8
TrEMBLA0A0D3E4731e-169A0A0D3E473_BRAOL; Uncharacterized protein
STRINGBra027722.1-P1e-168(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM149321720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64620.11e-114Dof family protein